genome

[spazm_1999]

I was watching mt genome processing when it completed a sequence. At the beginning to the sequence 22, it closed with an error...

Here's the error



It gives that error back everytime i restart it.... any idea?

Spazm

[-=Narcissus=-]

I'm not sure, but I think that you have a corrupt WU. if this is the case, just delete the input.* files. Better yet, just rename them temporarily to see is you can start g@h...

I am getting some corrupt WUs too... This has been the case since the new version. Has anyone else noticed the increase in client problems too?

Fred

[rocketmanx]

Yeah,
I had a bad one yestrerday that spit out out a bunch of jibberish during sequence 13.
Pete

[spazm_1999]

Damn... i whish that they correct that in the next version... i had 22 sequence done.

Spazm

[Mr D. Ackerot]

Problems? I caught this a day or two ago...

The protein was: SH3/pdb1fmk.1.spa
Genom@home v0.94 output

100.0 %
 Sequence 11 completed:
RKLFKAKENWTERSNWVLSAYQGQYIIAENFKSTDFIKIYSTETGETGYFTTPYIEQVNK
 Designing protein sequence 12  of 30
 10.0 %
jwe0217i-e In ASIN(x) or ACOS(x), ABS(x).gt.1.0 (x=-0.100000012e+01).
 error occurs at ???????? loc 0044cb5d
 ????????     at loc 00000000 called from loc 0044bd2b in ????????
 ????????     at loc 00000000 called from loc 0043a666 in ????????
 ????????     at loc 00000000 called from loc 0045a31a in ????????
 ????????     at loc 00000000 called from loc 0040d27d in ????????
 ????????     at loc 00000000 called from loc 004198a2 in ????????
 ????????     at loc 00000000 called from loc 004148a5 in ????????
 ????????     at loc 00000000 called from loc 0041d30d in ????????
 ????????     at loc 00000000 called from loc 0040a5bc in ????????
 ????????     at loc 00000000 called from loc 77e992a6 in ????????
 ????????     at loc 00000000 called from o.s.

[????????] : Program name cannot be printed for not finding COFF symbols.

taken to (standard) corrective action, execution continuing.
 20.0 %
 30.0 %
 40.0 %
 50.0 %
 60.0 %
 70.0 %
 80.0 %
 90.0 %
100.0 %
 Sequence 12 completed:
KRLYVAKSNWEQQSEYYLPSEQGQKIYVPDVNSSDYIKARSSSTGQEGQFEYNFVKLKGE
 Designing protein sequence 13  of 30
 10.0 %

I have no clue what went wrong, but I if I understand the message it fixed the problem.
This was the during the second run of the wu, this did not happen the first time (I think).

Daniel


[This message has been edited by Mr D. Ackerot (edited 29 March 2001).]

[Ant]

I've been having the same problem as Mr D with one of my clients.

[rocketmanx]

That's exactly what I got at sequence 13 yesterday.
Pete

[Jorden]

I've had errors like Mr. D's a couple of times. But always at the start of the unit. I let one of them run through, to see if it would continue, but it didn't (even though the message says it does).

I usually delete those input.* and rerun g@h and am on my way again.

Jord.

[Rattledagger]

I also got problems, but no error-messages.

My problem was that the client kept running and re-looping as it should, but didn't save the result. All intermediate-files was there as they should, but since no result, I killed all genome-clients, awaiting the next version...

[Liquid Snake]

I haven't seen such problems. I have lost a result once, but Genome has given no problems otherwise.

[Mr D. Ackerot]

Sorry I made a mistake, I'm running v. 0.94

(I corrected other post.)

I had some problems with 0.93 not saving the result, but 0.94 seams to do that right.
Sometimes 0.94 reruns the wu with the same seed number... I'm getting credit for both units so I'm not complaining

I don't have the link for the 0.94 version but I found it at Yahoo Groups: Genome@home it's a prerelease test version if my memory serves me correctly

/Daniel

[spazm_1999]

Ok... i got the 0.94 now i hope those probs won't happend with it.

for those who'd like to have the 0.94


<a href="http://www.multimania.com/spazm/ghclient094_win.exe">Windows</a>

<a href="http://www.multimania.com/spazm/ghclient094_linux.x.gz">Linux</a>

Spazm

[Rattledagger]

If I remember correctly, one of the re-loop, no result was with 0.94. At any case, I'm waiting for the next version before continuing.